| High dose vitamin D supplementation can improve menstrual problems, dysmenorrhea, and premenstrual syndrome in adolescents A Bahrami, A Avan, HR Sadeghnia, H Esmaeili, M Tayefi, F Ghasemi, ... Gynecological Endocrinology 34 (8), 659-663, 2018 | 142 | 2018 |
| Tumor‐derived exosomes: Potential biomarker or therapeutic target in breast cancer? AR Hesari, SA Golrokh Moghadam, AS Siasi, M Rahmani, N Behboodi, ... Journal of Cellular Biochemistry 119 (6), 4236-4240, 2018 | 48 | 2018 |
| The effects of vitamin D supplementation on indices of glycemic control in Iranian diabetics: A systematic review and meta-analysis R Sahebi, M Rezayi, M Emadzadeh, M Salehi, M Tayefi, SM Parizadeh, ... Complementary therapies in clinical practice 34, 294-304, 2019 | 30 | 2019 |
| Association of TNF‐308 G> A polymorphism located in tumor necrosis factor a with the risk of developing cervical cancer and results of pap smear N Babapour, M Mehramiz, A Rastgar Moghadam, N Behboodi, Z Yousefi, ... Journal of cellular biochemistry 120 (4), 5444-5448, 2019 | 20 | 2019 |
| Limb-girdle Muscular Dystrophy and Therapy: Insights into Cell and Gene-based Approaches. F Taheri, E Taghizadeh, MJR Pour, D Rostami, PG Renani, ... Current gene therapy 19 (6), 386-394, 2020 | 11 | 2020 |
| Association of cyclin‐dependent kinase inhibitor 2A/B with increased risk of developing breast cancer SSFPMRMMARMMGFRSSSMHMKPDSSPYSMRPGAFMFA Avan Journal of Cellular Physiology, 2019 | 11* | 2019 |
| Association of a genetic variant in the angiopoietin-like protein 4 gene with metabolic syndrome S Kharazmi-Khorassani, J Kharazmi-Khorassani, A Rastegar-Moghadam, ... BMC medical genetics 20, 1-6, 2019 | 9 | 2019 |
| Association of a variant in the tumor necrosis factor alpha gene with risk of cervical cancer N Behboodi, M Farazestanian, A Rastgar-Moghadam, M Mehramiz, ... Molecular Biology Reports 48, 1433-1437, 2021 | 8 | 2021 |
| Is there any association between Serum anti-HSP27 antibody level and the presence of metabolic syndrome; population based case-control study F Sadabadi, A Heidari-Bakavoli, H Esmaily, S Darroudi, M Tayefi, Z Asadi, ... Revista Romana de Medicina de Laborator 27 (2), 179-187, 2019 | 8 | 2019 |
| Association of a genetic variant in ATP‐binding cassette sub‐family B member 1 gene with poor prognosis in patients with squamous cell carcinoma of the esophagus A Rastgar‐Moghadam, M Mehramiz, S Shahidsales, M Entezari, ... IUBMB life 71 (9), 1252-1258, 2019 | 7 | 2019 |
| A Genetic Polymorphism in the CYP1B1 Gene in Patients with Squamous Cell Carcinoma of the Esophagus: An Iranian Mashhad Cohort Study Recruited Over 10 … AR Moghadam, M Mehramiz, M Entezari, H Aboutalebi, F Kohansal, ... Pharmacogenomics 19 (6), 539-546, 2018 | 7 | 2018 |
| Physical activity level (PAL) and risk factors of cardiovascular disease in the MASHAD study cohort F Sadabadi, RG Zirak, H Ghazizadeh, AR Moghadam, M Mouhebati, ... Diabetes & Metabolic Syndrome: Clinical Research & Reviews 15 (6), 102316, 2021 | 6 | 2021 |
| Interaction between a genetic variant in vascular endothelial growth factor with dietary intakes in association with the main factors of metabolic syndrome H Ghazizadeh, H Esmaily, P Sharifan, SMR Parizadeh, GA Ferns, ... Gene Reports 21, 100813, 2020 | 5 | 2020 |
| The therapeutic potential of MEK1/2 inhibitors in the treatment of gynecological cancers: rational strategies and recent progress S Ghanaatgar-Kasbi, M Khazaei, A Rastgar-Moghadam, GA Ferns, ... Current Cancer Drug Targets 20 (6), 417-428, 2020 | 5 | 2020 |
| Association of a genetic variant in chromosome 9p21 with increased risk of developing cervical cancer M Atabati, R Saber, P Malakuti, G Pourali, M Heydari-Majd, P Safavi, ... Current Cancer Therapy Reviews 19 (4), 358-362, 2023 | 3 | 2023 |
| The association between genetic variants in the genes for cytochrome P450 B1 and ATP-binding cassette transporter genes and breast cancer risk S ShahidSales, M Mehramiz, D Radmanesh, A Rastgar-Moghadam, ... Molecular Biology Reports 47, 6009-6014, 2020 | 3 | 2020 |
| Association between the Cx371019 C> T genetic variant and risk of breast cancer M Tabadkani, N Bani, M Gharib, A Ziaeemehr, S Samadi, ... Meta Gene 29, 100925, 2021 | 2 | 2021 |
| Single Nucleotide Polymorphisms as the Efficient Prognostic Markers in Breast Cancer M Alimardani, M Moghbeli, A Rastgar-Moghadam, FH Shandiz, ... Current Cancer Drug Targets 21 (9), 768-793, 2021 | 1 | 2021 |
| Limb Girdle Muscular Dystrophy and Therapy: Current progress in Cell and Gene-based approaches. F Taheri, E Taghizadeh, MJR Pour, D Rostami, PG Renani, ... Current gene therapy, 2020 | 1 | 2020 |
| Transplanted human photoreceptors transfer cytoplasmic material but not to the recipient mouse retina MT Ho, K Kawai, D Abdo, L Comanita, A Ortin-Martinez, Y Ueno, E Tsao, ... Stem Cell Research & Therapy 15 (1), 79, 2024 | | 2024 |
Gordon FernsBrighton and Sussex Medical School在 bsms.ac.uk 的电子邮件经过验证
