Familial mutants of α-synuclein with increased neurotoxicity have a destabilized conformation
CW Bertoncini, CO Fernandez, C Griesinger… - Journal of Biological …, 2005 - ASBMB
A30P and A53T mutations of the presynaptic proteinα-synuclein are associated with familial
forms of Parkinson disease. NMR spectroscopy demonstrates that Parkinsonism-linked …
forms of Parkinson disease. NMR spectroscopy demonstrates that Parkinsonism-linked …
Coordination abilities of N-terminal fragments of α-synuclein towards copper (II) ions: A combined potentiometric and spectroscopic study
T Kowalik-Jankowska, A Rajewska… - Journal of inorganic …, 2005 - Elsevier
Copper (II) complexes of the 1–17 (MDVFMKGLSKAKEGVVA-NH2), 1–28 (
MDVFMKGLSKAKEGVVAAAEKTKQGVAE-NH2), 1–39 (MDVFMKGLSKAKEGVVAAAEKTKQGVAEA …
MDVFMKGLSKAKEGVVAAAEKTKQGVAE-NH2), 1–39 (MDVFMKGLSKAKEGVVAAAEKTKQGVAEA …
Metals accelerate the formation and direct the structure of amyloid fibrils of NAC
A Khan, AE Ashcroft, V Higenell… - Journal of inorganic …, 2005 - Elsevier
Non-beta amyloid component of Alzheimer's disease amyloid or NAC is a highly
amyloidogenic peptide consisting of 35 amino acids which was first identified associated …
amyloidogenic peptide consisting of 35 amino acids which was first identified associated …
[PDF][PDF] Familial Mutants of-Synuclein with Increased Neurotoxicity Have a Destabilized Conformation* DS
CW Bertoncini, CO Fernandez, C Griesinger, TM Jovin… - 2005 - academia.edu
A30P and A53T mutations of the presynaptic protein-synuclein are associated with familial
forms of Parkinson disease. NMR spectroscopy demonstrates that Parkinsonism-linked …
forms of Parkinson disease. NMR spectroscopy demonstrates that Parkinsonism-linked …